McDonnell Genome Institute

Washington University

CircRNA

chr19|38152839|38164906|+|SIPA1L3|ENST00000222345.10

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9967

363

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

3

13

Peptide

DWRGAAETHRGSPGTR

Amino Acids from 5' Exons

VHGCPTPPAISSPLQPRWDVQRRLLFRRPDQPGEHHGTPEA,YTAAPHPLLSLDPHFSHDGTSSGDSSSGGLTSQESTMERQKP,TRLPHTPCYLLIPTSATMGRPAATPLPAAPARRAPWNARSQ

Amino Acids from 3' Exons

GEPQYSSHSSSNTLSSNASSSHSDDRWFDPLDPLEPEQDPLSKGGSSDSGIDTTLYTSSPSCMSLAKAPRPAKPHKPPGSMGLCGGGREAAGRSHHADRRREVSPAPAVAGQSKGYRPKLYSSGSSTPTGLAGGSRDPPRQP,ENLNTQVIPAATPSPATHPAATATTAGSTPWTPWSQSKTPSPRVALVTAASTPPSTPPALAACPWPRLHGPPSHTSPLEVWAFVAGVARPLGGPTTQTGGGRSPLPPQLPAKARATDRSCTPPAPAPPRDWRGAAETHRGSP,RTSILKSFQQQHPLQQRIQQPQRRPLVRPPGPPGARARPPLQGWLQRHRHHPLHLQPLHVPGQGSTARQATQAPWKYGPLWRGSRGRWEVPPRRQAAGGLPCPRSCRPKQGLPTEAVLLRLQHPHGTGGGQPRPTEAAQ