McDonnell Genome Institute

Washington University

CircRNA

chr19|3743938|3748081|+|TJP3|ENST00000539908.6

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9831

3

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

6

8

Peptide

ISAHQGAQPVSSAR

Amino Acids from 5' Exons

PVSSARSWDPWPTLLCRSLLRCLTSLKSQ,QFQAPGSDPGTRGRHCYAEVDCDAPVNR,SFKRPVVILGPVADIAMQKLTAEMPDQFEIA

Amino Acids from 3' Exons

LDGSLEDNLDLPHHGLADSSADLSCDSRVNSDYETDGEGGAYTDGEGYTDGEGGPYTDVDDEPPAPALARSSEPVQADESQSPRDRGRISAHQGAQ,WMAPWRTTTSLTTAWPTAPLTSAATAALTATTRRTARAARTRMARATQTARGGPTRMWMMSPRLQPWPGPRSPCRQMSPRARGIVGESRLIRGP,GWLLGGQPRPPSPRPGRQLRPQLRQPRQRLRDGRRGRRVHGWRGLHRRRGGALHGCGAPGSSPGPVLGARAGRVPEPEGSWENLGSSGGP