McDonnell Genome Institute

Washington University

CircRNA

chr19|37127127|37128402|+|ZNF420|ENST00000304239.11

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9927

5

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

4

4

Peptide

IHTDLPSR

Amino Acids from 5' Exons

TCLQGVQVRTYLQKRTLMKQNYPNGKVTDLKTVILKSPIPGIIWKPKARWRSNKKIRRNISGKGSYMTKCPFSTSILTYLNIQDVILLRNPINVRNVGKPSDEPHTHNIKVFILVKNPMNVSNAGRPLVVIHNSVFIRDFILVRNPMHVRNVGRPLLKAHNLFYIIEFILVKNHINVKNVGKPLFVAHNLPDIKKFILVRNLMNVKNVGRPLLRIHNLHYTRDFILVKSSMNVKNVGRSLLSSHNLFCIREFIPVRNPMNVRNVEKLLFVAHSFLNIRKFIMGKNHMNVRNVEGPLFGAHYCNIRGFILVKNPINVKNVGRPLSVAHNLLNTREFTPMKSPMNVRNVERCLVMAHNLLNIREYTLVRNPINVRNVEKRLIVAHSLHDTRGFILVRNPMNVKNVEKPLVVAQNLLNMSEFTQ,LAFKVCKGLISRKEHLNRIIPMGNEQTKLSRVQFQGLFGSQRQDGEATRKSEGIFQARDDHIQNVHFQPAYLLISTFKMSFYETLMGMWESLQTSLTPNTTSKYSYWKTLMAMREGLSFTTQSSSETSYWETLCMGMWEGLYSKLTTYFTSNSYWKTIMRMWESLYSLTTYPTSKSSYWETLMRMWEGLYSEFTTYTTPETSYWKALMRMEGLYSALTTYSAENSYRETLMGMWKSFYLWLTAFSTSENSWGKTIMGMWKGLYSGLTTDATSEDSYWKTLMRMWEGLYPWLTTYSTPENSHQKALMGMWKDVSWLTTYSTSENTHWETLSMGMWKSVSWLTPYTTPEDSYWETLMRMWKNLSWLRTYSTANSH,LPSRCASKDLSPEKNTYETELSQWEMSDRLENCDLEESNSRDYLEAKGKMEKQQENQKEYFRQGMIIYDKMSIFNQHTYLSQHSRCHSTEKPYKCKECGKAFRRASHLTQHQSIHTGEKPYECKQCGKAFSRDSQLSLHQRLHTGEKPYACKECGKAFTQSSQLILHHRIHTGEKPYKCEECGKAFIRSSQLTRHQKVHTGEKPYECKECGKAFTQNSQLTLHQRLHTGEKLYECKECRKVFTQLSQLILHKRIHTGEKPYECKECGKAFICGSQLSQHQKIHNGEKPYECKECGRAFIRGSLLMQHQRIHTGEKPYKCEECGKAFIRGSQLTQHQRIHTNEKPYECKECGKMFSHGSQLTQHQRIHTGEKPYQCKECGKAFNRGSLLTRHQRIHTGEKPYECKECGKTFSRGSELTQHERIHT

Amino Acids from 3' Exons

TCLQGVQVRTYLQKRTLMKQNYPNGKVTDLKTVILKSPIPGIIWKPKARWRSNKKIRRNISGKGSYMTKCPFSTSILTYLNIQDVILLRNPINVRNVGKPSDEPHTHNIKVFILVKNPMNVSNAGRPLVVIHNSVFIRDFILVRNPMHVRNVGRPLLKAHNLFYIIEFILVKNHINVKNVGKPLFVAHNLPDIKKFILVRNLMNVKNVGRPLLRIHNLHYTRDFILVKSSMNVKNVGRSLLSSHNLFCIREFIPVRNPMNVRNVEKLLFVAHSFLNIRKFIMGKNHMNVRNVEGPLFGAHYCNIRGFILVKNPINVKNVGRPLSVAHNLLNTREFTPMKSPMNVRNVERCLVMAHNLLNIREYTLVRNPINVRNVEKRLIVAHSLHDTRGFILVRNPMNVKNVEKPLVVAQNLLNMSEFTQ,LAFKVCKGLISRKEHLNRIIPMGNEQTKLSRVQFQGLFGSQRQDGEATRKSEGIFQARDDHIQNVHFQPAYLLISTFKMSFYETLMGMWESLQTSLTPNTTSKYSYWKTLMAMREGLSFTTQSSSETSYWETLCMGMWEGLYSKLTTYFTSNSYWKTIMRMWESLYSLTTYPTSKSSYWETLMRMWEGLYSEFTTYTTPETSYWKALMRMEGLYSALTTYSAENSYRETLMGMWKSFYLWLTAFSTSENSWGKTIMGMWKGLYSGLTTDATSEDSYWKTLMRMWEGLYPWLTTYSTPENSHQKALMGMWKDVSWLTTYSTSENTHWETLSMGMWKSVSWLTPYTTPEDSYWETLMRMWKNLSWLRTYSTANSH,LPSRCASKDLSPEKNTYETELSQWEMSDRLENCDLEESNSRDYLEAKGKMEKQQENQKEYFRQGMIIYDKMSIFNQHTYLSQHSRCHSTEKPYKCKECGKAFRRASHLTQHQSIHTGEKPYECKQCGKAFSRDSQLSLHQRLHTGEKPYACKECGKAFTQSSQLILHHRIHTGEKPYKCEECGKAFIRSSQLTRHQKVHTGEKPYECKECGKAFTQNSQLTLHQRLHTGEKLYECKECRKVFTQLSQLILHKRIHTGEKPYECKECGKAFICGSQLSQHQKIHNGEKPYECKECGRAFIRGSLLMQHQRIHTGEKPYKCEECGKAFIRGSQLTQHQRIHTNEKPYECKECGKMFSHGSQLTQHQRIHTGEKPYQCKECGKAFNRGSLLTRHQRIHTGEKPYECKECGKTFSRGSELTQHERIHT