McDonnell Genome Institute

Washington University

CircRNA

chr19|35766767|35768236|+|PROSER3|ENST00000620918.4

Cancer

Type of Peptide

OV

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9997

5

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

8

1

Peptide

VQATQPQTK

Amino Acids from 5' Exons

HPRHQPRPRPPPLLQPQPPPKHPFGQRMTFCTSGGSGGSLNRLREARVTELGCRLPLPSARWAEGGRSLGGAGGGAGSEGDGPSTLSLSVSDLSYLSTDLSCSSGDPQFSGDPAPCPTVEQCGPAWSTRGLLCGEASFSLSVLSTHLLGPQLPRVLLGPTVWALGIPWGCSSHAAGLHPSTSGLYPRAPGFPGLHPRTPGLHPSSPGLHPCTPSLHPGSPGLYPCTSSLHPRIPSCPPGPAHPPKQLCPAEPGAQVSEEQSPSPRGCRASPCSWPGTWPSAQGCPGPGSGSSAVPQPGGHASSLRGPPSTQGWISESPGHTTPNQGHSPSIIPVSGQGRVSESQGLAARSGVSDTEERSHSFPWSLPAARGPTLSSAGNHSQGLAASLPGGVSGGPGPAPARCPRPLGGPACPGRPAAAGCR,IPGTSPGPDPHPCSSPSLLPSTPSARGHSVPVAAAAEATGSGKQGQSLGAASDPCPPHVGEPREGGAWGELEEGLGLRGTEDPPPSLSLSQISLICLQTSPAPVETLSSLGTQPNHVPLWSSVAQPGPPEAFYVERPPFPSVSSPHIFWAPSSHGFFWAPQSGPWVSLGAVPPTQQASTLAHLGSTLAPPASLASTLEPPASTPAPLASTLAPPASTPAPLACTPAPPASTLASPAVPQGLPIPDPSSCAQPKSLGPKSRRSRAPRPEAAEQVPAAGQGPGPQLRGVLGQVVAARLFPDSLEDTPPHFEGPPPPKAGSPKVQATQPQTKVTPPPSESQCRAKAESLKAKALPPAAGSVIRKSEATPSPGACLQPEVPLSPAEQATTVKASPPAFQVGSPEALAPPPPAADHAPSEALLAQAALLLQAAE,SPAPAQAQTPTPAPAPASSQAPLRPEDDILYQWRQRRKLEQAQGSKGDRAWVPPLTPALRTLVSRGREEPGGSWRRGWVGGLRTLHPLSLCLRSLLSVYRPLLLQWRPSVLWGPSLTMSHCGAVWPSLVHQRPSMWRGLLFPQCPLHTSFGPPAPTGSSGPHSLGLGYPLGLFLPRSRPPPHIWALPSRPRLPWPPPSNPRPPPQLPWPPPLHPQPPPRLPWPVPLHLQPPPSHPQLSPRACPSLTQAAVPSLRAWGPSLGGAEPLAQRLPSKSLQLARDLALSSGVSWARWQLGCSLTAWRTRLLTSRAPLHPRLDLRKSRPHNPKPRSLPLHLNPSVGPRPSLKPRPCRPQRGQYGRAKPLLPLEPACSPRSHSLQLSRQPQSRPRRQPSRWGLRRPWPRPRPLLTTPPRRPCLPRPPCCCRLQK

Amino Acids from 3' Exons

TPTAASSRTIPCCRCEPIGQSVGRK,LRRQRVPGRSRAAGAKSPGRAESAEK,SDGSEFQDDPVLQVLRAHRAELSRQK