McDonnell Genome Institute

Washington University

CircRNA

chr19|34409160|34413847|+|PDCD2L|ENST00000246535.3

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9815

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

1

7

Peptide

LSGADFEK

Amino Acids from 5' Exons

KQGNSLAAEDWCEGADDWGSDTEEGPSPQFTLDFGNDASSAKDVDWTARLQDLRLQDAVLGAAHPVPPGLPLFLPYYICVADEDDYRDFVNLDHAHSLLRDYQQREGIAMDQLLSQ,NRETALQLRTGVKVLMTGEVILRRGLHHSLPWILGMMPAVPKTTGLLGSKTSACRMLSWVLPILCLLGCRSSCPTTSVLQMRMITGTLSTWIMPTAFGTISREKALPWISCFPK,TGKQPCSGLVRCLGKYGGAFTTVYLGFWECQQCQRRRLDCSAPRPPPAGCCPGCCPSCASWAAALPALLHLCCRGLQGLCQPGSCPQPSEGLSAERRHCHGSVAFPK

Amino Acids from 3' Exons

PSWKIEDHNKWRSDVLQIHEANCCLSGADFE,LPNDGDEKYEKTIIKSGDQTFYKFMKRIAACQEQIL,FLMMVMKNMRRPLKVEIRRFTNSSELLLVRSRF