McDonnell Genome Institute

Washington University

CircRNA

chr19|34377502|34377881|+|GPI|ENST00000356487.9

Cancer

Type of Peptide

CCRC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

1

7

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

1

17

Peptide

TLAQLNPESSLFIIASKR

Amino Acids from 5' Exons

RVRSGDWKGYTGKTITDVINIGIGGSDL,VSGAVTGRGTQARPSRTSSTLALAAPT,CPERLEGVHRQDHHGRHQHWHWRLRP

Amino Acids from 3' Exons

GPLMVTEALKPYSSGGPRVWYVSNIDGTHIAKTLAQLNPESSLFIIASK,DPSWLKPLSHTLQEVPASGMSPTLMELTLPKPWPSTPSPPCSSLPP,TPHGDSPAILFRRSPRLVCLQHWNSHCQNPGPAEPRVLPVHHCLQ