McDonnell Genome Institute

Washington University

CircRNA

chr19|34194477|34215300|+|LSM14A|ENST00000433627.9

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9443

5

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

7

4

Peptide

STGEFDPLVQK

Amino Acids from 5' Exons

FDPLVQKTDRQIVQYHLEMKSLNTLYSVGVTLKTLLFVSHQNHSVLCLKTQLLF,SILWYRRQTDRSSNTTSRSLIHYIPWEHRPYCLATKTTVFFASRPSYCS,RSFGTEDRPTDRPIPPRDEVFEYIIFRGSDIKDLTVCEPPKPQCSLPQDPAIVQ

Amino Acids from 3' Exons

VAQALSTLEKAQPWNKQCRPPQPTYLLQQLLGEGVLYQPGLCHLPAKRQERIRSTGE,SLKPSVRPFEKKPNHGTSSADRLSPLTCSSSCWEKESCINQAFAICQPKGRRESGAQA,RSSPQLDPLRKSPTMEQAVQTASAHLPAPAAVGRRSPVSTRPLPSASQKAGENQEHRR