McDonnell Genome Institute

Washington University

CircRNA

chr19|33095761|33096446|+|GPATCH1|ENST00000170564.6

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9608

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

5

7

Peptide

KLGISGQILESK

Amino Acids from 5' Exons

ILESKSMAVHYPLEARKDL,SWSQNLWLCITPWKLGRI,PGVKIYGCALPPGSSEGSE

Amino Acids from 3' Exons

GEDDDYLPDNVTFAPKDVTPVDFTPKDNVHGLAYKGLDPHQALFGTSGEHFNLFSGGSERAGDLGEIGLNKGRKLGISGQ,VKMMTTCLIMPLHPKMSHLWISHLKIMCMVLTRAWIPTRHCLELRENILIFSVVVLRELAILEKLDIKEENWEFQA,RLLACDLCTQRCHTCGFHTRCAWSSLQGPGSPPGTVWNFGRTFSFQWWFESWRSWRNWTERKKIGNFRP