McDonnell Genome Institute

Washington University

CircRNA

chr19|33012646|33026632|-|RHPN2|ENST00000254260.7

Cancer

Type of Peptide

HCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9995

40

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

12

Peptide

GAGASAAGAELR

Amino Acids from 5' Exons

DFILEHYSEDGYLYEDEIADLMDLRQ,ILSWNITVKMAIYMKMKLQILWID,FYPGTLQRWLFIRNCRSYGSET

Amino Acids from 3' Exons

SGHKLKGAGASAAGAELRQLRPADAQGRAGGAEHLGGRLSEHR,VATNSKVREQVRLELSFVNSDLQMLKEELEGLNISVGVYQNT,WPQTQRCGSKCGWSASSTQTCRCSRKSWRGTSRWASIRTQ