McDonnell Genome Institute

Washington University

CircRNA

chr19|32617588|32622619|-|ANKRD27|ENST00000306065.8

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9499

3

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

9

3

Peptide

AVADGDLEMCVK

Amino Acids from 5' Exons

VEKLLRAVADGDLEM,KNFEQLLMEIK,RKTFESSCWRSRN

Amino Acids from 3' Exons

CVKALVYYDVESCRLDIGNEKGDTPLHIAARWGYQGVIETLLQNGASTEIQNRLKETPLKCALNSK,VRLWFTTTWSRADLTLAMRKETPLYTLLPAGATKASRHCCRTERPPRSRTDRRRPSSVHTQ,CEGSGLLRRGVVQTHWQERRHPSTHCCPLGLPRRHRDIAAERSVHRDPEQTEGDAPQVCIKLK