McDonnell Genome Institute

Washington University

CircRNA

chr19|29986281|30012531|+|URI1|ENST00000360605.8

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9328

9

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

12

9

Peptide

LLPLSVTPEVPFGPFAFMPGK

Amino Acids from 5' Exons

VPFGPFAFMPGKLVHTNEVTVLLGDNWFAKCSAKQAVGLVEHRKE,YHLALLPSCQENLSILMKSLFYWGTTGLQSAQQSRLVLSTGKN,TIWPFCLHARKTCPYSHCFTGGQLVCKVLSKAGCRFSAPER

Amino Acids from 3' Exons

SLCCCEWRICPSQIHPEVSKRECVRHKQCCIAGSFEEYQLRRSHLQHQEHFGRGTTRKSKETFALISNT,AFVDVVNGEYVPRKSILKSRSRENSVCSDTSESSAAEFDDRRGVLRSISCEEATCSDTSESILEEEPQENQKKLLPLSVTPE,PLLMLMENMSLANPSSLEVERIVCVATLVKAVLLNLMIGGEFGVSAAKKPLAVTPVRAFWKRNHKKIKRNFCPYQHL