McDonnell Genome Institute

Washington University

CircRNA

chr19|2476528|2477251|+|GADD45B|ENST00000585359.1

Cancer

Type of Peptide

OV

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9561

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

5

3

Peptide

GGGAFGGR

Amino Acids from 5' Exons

DADGDRRGGGAFGGRSAPGSPHSGGVRVGQVDE,MQTVTAAVEELLVAAQRQDRLTVGVYESAKLMN,CRRPPRWRSFWWPLSARIASQWGCTSRPS

Amino Acids from 3' Exons

GPRQRGPLPLGHRGGGGHRPANPLHAHPVLLLQRHQHRAGVGHAAPGAAPGRAGRDPGHHRGPRPALSPGH,DPDSVVLCLLAIDEEEEDDIALQIHFTLIQSFCCDNDINIVRVSGMQRLAQLLGEPAETQGTTEARDLHCLLVT,TQTAWSSASWPLTRRRRMTSPCKSTSRSSSPSAVTTTSTSCGCRACSAWRSSWESRPRPRAPPRPETCIVSWS