McDonnell Genome Institute

Washington University

CircRNA

chr19|2438162|2444540|-|LMNB2|ENST00000325327.3

Cancer

Type of Peptide

HCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9681

4

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

5

5

Peptide

SVFEEVSGIK

Amino Acids from 5' Exons

AEDGHAVAKKQLEKETLMRVDLENRCQSLQEELDFRKSVFEE,PRTVMQWPKSSWRRRRCVWTWRTAARACRRSWTSGRVCSR,RGRSCSGQKAAGEGDADACGPGEPLPEPAGGAGLPEECVRG

Amino Acids from 3' Exons

VSGIKALYESELADARRVLDETARERARLQIEIGKLRAELDEVNK,VASRRCTSRSWPMPGESWMRRLESVPGCRRLGSGQSWTRSTR,EWHQGAVRVGAGRCPESPGDGSRACPAADRDWEAEGRVGRGQQE