McDonnell Genome Institute

Washington University

CircRNA

chr19|2433825|2434105|-|LMNB2|ENST00000325327.3

Cancer

Type of Peptide

BRCA-Luminal A

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9489

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

11

Peptide

AEAVPQPILAR

Amino Acids from 5' Exons

AEAVPQPILARHRLTSHLEQQRQLVRHRAPGPQAEAAGGGGALGQRPKRPGHGHGWQRWLPPGPAGLGLGRQHRGDRPGGQVCAAQEQLGQ,LKLSPSPSSRVTVSRATSSSSGSLSATGRLGRSKRKRLEVEEPLGSGPSVLGTGTGGSGGFHLAQQASASGSVSIEEIDLEGKFVQLKNNSDK,SCPPAHPRASPSHEPPRAAAAACPPPGAWAAVSGSGWRWRSPWAAAQASWARARVAAVASTWPSRPRPRVASASRRSTWRASLCSSRTTRT

Amino Acids from 3' Exons

AEAVPQPILARHRLTSHLEQQRQLVRHRAPGPQAEAAGGGGALGQRPKRPGHGHGWQRWLPPGPAGLGLGRQHRGDRPGGQVCAAQEQLGQ,LKLSPSPSSRVTVSRATSSSSGSLSATGRLGRSKRKRLEVEEPLGSGPSVLGTGTGGSGGFHLAQQASASGSVSIEEIDLEGKFVQLKNNSDK,SCPPAHPRASPSHEPPRAAAAACPPPGAWAAVSGSGWRWRSPWAAAQASWARARVAAVASTWPSRPRPRVASASRRSTWRASLCSSRTTRT