McDonnell Genome Institute

Washington University

CircRNA

chr19|2210399|2217918|+|DOT1L|ENST00000398665.7

Cancer

Type of Peptide

PRAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9956

3

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

6

2

Peptide

AEEQEAAR

Amino Acids from 5' Exons

EEQEAARRRQQRESKSNAATPTKGPEGKVAGPADAPM,RNRRQPGAASSARARATRPRPLRAQRARWPAPPTPP,GTGGSPAPPAAREQEQRGHAHGPRGQGGRPRRRPH

Amino Acids from 3' Exons

GLRERAYGSSGELITSLPISIPLSTVQPNKLPVSIPLASVVLPSRAERA,AESAPTAAAGSSSPACPSASRSAPCSPTSSRSAFPWPAWCCPAAPRG,PERARLRQQRGAHHQPAHQHPAQHRAAQQAPGQHSPGQRGAAQPRREG