McDonnell Genome Institute

Washington University

CircRNA

chr19|2078139|2078679|-|MOB3A|ENST00000357066.7

Cancer

Type of Peptide

CCRC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9684

65

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

3

23

Peptide

YMDLLMDWIEAQINNEDLFPTNVGPR

Amino Acids from 5' Exons

VRGRAVGLGECFVASRVGQHPQPAGPGPLYRSPGEQASPRCPTPSSKSSTRTRHSAPSASLSQAPSASSCTRRRRRRTPGWTCGWPCSCPRARTTTGWLFTWWTSLTASTSSTAPSATAARSSPAPSCRGAPSMSTAGRMSISSGSPRHSPRPGTWTCWTGSRRRSTTRTSSPPTL,SAGELWGLVSVSWPLGLVSTPSQLAQDPSTEVQESRRHQDVQPLPEASLQQGQDIPPQAQVARHPALRAAQEGAGVAERRAGPAAGRAVAPGRGPERLGGCSRGGLLPRQPHLRHHQRRLHGAVLPRHVGGPQVVPLAGAVPEAHGTLRAQVHGPADGLDRGADQQRGPLPHQR,PRESCGAWVFRGLSGWSAPPASWPRTPLQKSRRAGVTKMSNPFLKQVFNKDKTFRPKRKFEPGTQRFELHKKAQASLNAGLDLRLAVQLPPGEDLNDWVAVHVVDFFNRVNLIYGTISDGCTEQSCPVMSGGPKYEYRWQDEHKFRKPTALSAPRYMDLLMDWIEAQINNEDLFPTNV

Amino Acids from 3' Exons

VRGRAVGLGECFVASRVGQHPQPAGPGPLYRSPGEQASPRCPTPSSKSSTRTRHSAPSASLSQAPSASSCTRRRRRRTPGWTCGWPCSCPRARTTTGWLFTWWTSLTASTSSTAPSATAARSSPAPSCRGAPSMSTAGRMSISSGSPRHSPRPGTWTCWTGSRRRSTTRTSSPPTL,SAGELWGLVSVSWPLGLVSTPSQLAQDPSTEVQESRRHQDVQPLPEASLQQGQDIPPQAQVARHPALRAAQEGAGVAERRAGPAAGRAVAPGRGPERLGGCSRGGLLPRQPHLRHHQRRLHGAVLPRHVGGPQVVPLAGAVPEAHGTLRAQVHGPADGLDRGADQQRGPLPHQR,PRESCGAWVFRGLSGWSAPPASWPRTPLQKSRRAGVTKMSNPFLKQVFNKDKTFRPKRKFEPGTQRFELHKKAQASLNAGLDLRLAVQLPPGEDLNDWVAVHVVDFFNRVNLIYGTISDGCTEQSCPVMSGGPKYEYRWQDEHKFRKPTALSAPRYMDLLMDWIEAQINNEDLFPTNV