McDonnell Genome Institute

Washington University

CircRNA

chr19|19791561|19795660|-|ZNF506|ENST00000443905.6

Cancer

Type of Peptide

OSCC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9899

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

16

5

Peptide

SFTQAGVLWHDLGSLQPPPPR

Amino Acids from 5' Exons

MESRSFTQAGVLWHDLGSLQPPPPRFTPFSCLSFLSSWDYRHPPPCPANFFVFLVEMGFHCVSRDGQSPDLVIRPPRPPKVLGLQAATAPGHYATNFNLSHLNQGCTKMVTIYCLVRSGITSLLVTLPVALNCKVELFPLKFFFLLKSITSICGYTVCVYLYALYGIFFRPTICSNYIRVKYPSPLAFILITVLYIFNYFKMYNIVTDYRFIFMVIIKIIQKNKNMARCSGSGLSQHFPRQVDCLRSGVQDHPGQHSETPSEEALLSRGHSLWMNKVHHTFCSASPAEGPSRLQAP,WSLGLSPRLECCGTISAHCNLHLPGSHHSPASASVAGTTGTRHHARLIFLYFRWGFTVLAGMVNLLTLSAHLGLPKCWDYRREPPHLAIMPLTLTYPTLIKGVLKRWQYTVWYVVEHLYLSLCQWLTANELNCSHSLNFFSYNLLLVFVGIQYVYIFMPYMAYFDSGLQYVVITLGSIHHLHLSFELQCNYTFLIILKCTIKLLLTTGLFLWSKLYRKINKIWPGAVAQACNPSTFQGRWIVGQEFKTILANIVKPRLRKRSFRGGTRCGIKYTDTHSALPVQLRVRAAYRLQ,GVSVFHPGWSAVARSRLTATSTSQVHTILLPQLPELGLQAPATMPGFFCIFSRDGVSLCPGWSISPCDPPTSASQSAGITGVSHRTWPLCHLPIPPSRVYLKDGNNILFGTWNNISTCHFASGFKLQMSIVPIAIFFLIEIYYYLWVYSMCISLCLIWHILIQAYNMLHGKVSITSSIYPLNYSVIIHFLFNVQLNCYLQVYFYGHNKNYTEKIKYGQVQWLRPVIPALSKAGGLSEVRSSRPSWPTNPVGSAPFAGALAVDESTLTHILLCQSSGSEPLTGSK

Amino Acids from 3' Exons

LCILILPKTFGQSRAKILSKKYEDMKNVDMTIYSKKAVKVMSVQCTKEVIMDLNNVWQLPREKYFNVMNMNSCINFQIQTNIREILEKNLLNVNMGKLLTSLQPVLHIRKLMLERNAINVKNVVKPISSPHTLLHIRKFILERNPTNVKNVAKPISSPVTLLHIRFILERNPTDVENVAKLLTTLQPFFHIRKFILERNHTSVINVAKPLFHPQPLLNMRFILERNPTNVRNVAKLLTVPQTLLNIREFILEMYPTNVTNVAKPLPGTQASLNIRELILERNPTSVKNVAKPLLHSQLLNIRFILERNRTNVKNVAKLLTGPQPLINIRKFILDRNPARMWKIFMFLNPADNSYWRETVMMWESLLALDSDIEFIWNINPTNIKNVTKLFKEVLNPYYTFILDRNPTSVKNMAKPITTCQLFLFFEMEFHSCHPGWSAMARSQLTATSASWYQAILLPQPPELGLLVPTTMPSFLYFRWGFIMFARLVSNSPQMVHPPRHPKVLRQAATTPSHKFSILKRHGDNSCRGTLQTKMQQCFYHHLQLLYTKIILMNPGNVNETKRLYGCHTL,YVFSFCPRPLVRAEHKRFFPKSDTKKIKMTQFTVKKRLKCRVSSAQKRLWTTMFGNYPEKNISMICEILAIFKFKQTDKRYWKKIFMYRIWENFPVFNPYYIENCWRETLMRMWSLAVLTPYYTENSYWRETLQMRMWQSLAVLPYYTDNSYWRETLQMRMWQSFPPCNPFFTENSYWRETIQVMWQSLYFILNPYTDNSYWRETLQMGMWQSFPFLKPYTENSYWRCTLQMRMWQNLYLVLKPLTESSYWRETLQVRMWQSLYCILNSNTDNSYWRETVQMRMWQSFLVLSPTENSYTETLHSEECGKSFKCSSTLNKHKIIHTGEKPYECDECGKAFNPWTLTKYENLYGTTLQIRMQSFLRKFSTLITHNLYWTETLQVRIWQSLQPVNSFCFLRWSFTLVTQAGVQWHDLSSLQLLPPGIKPFSCLSLPSSWDYWCPPPCPANFCIFSRDGVSSCLPDWSPTPDLRWSTHLGILKCDDRHEPRRPATSSQFLRDMAIIHAEEELYKPERCNSAFTTTSNFCIHKNKLYCETLEMYEMRQSVYMVATLDC,MYSHFAQDLWSEQSIKDSFQKVILRRYEKCRHDNLQLKKGCESVDECPVHKRGYNGLKQCLATTQRKIFQCDEYVKFLHKFSNSNKHKIRDTGKKSFKCIEYGKTFNQSSTRTTYKKIDAGEKRYKCEECGKAYKQSSHLTTHKKIHTGEKPYKCEECGKAYKQSCNLTTHKIIHTGEKPYRCRECGKAFNHPATLFSHKKIHTGEKPYKCDKCGKAFISSSTLTKHEIIHTGEKPYKCEECGKAFNRSSNLTKHKRIHTGDVPYKCDECGKTFTWYSSLSKHKRAHTGEKPYKCEECGKAFTAFSTLTEHKIIHTGEKPYKCEECGKAFNWSSALNKHKKIHIRQKPCIVKNVENLLNVPQPLISIRFILERNRMNVMNVGKPLTSPGLLNMRIYMEHKPYKYKECDKAFGSSQPLLHIIYTGQKPYKCEEYGKAYNNLSTLFVFDGVSLLSPRLECNGTISAHCNFCLLVSSHSPASASRVAGITGAHHHAQLIFVFLVEMGFHHVCQTGLQLLTSDGPPTSASSAEMTGMSHDAQPQVLNSETWRFMLKRNSTNLKDATVLLPPPPTFVYIKINYTNVKPWKCMKDKAFIWLPHLIV