McDonnell Genome Institute

Washington University

CircRNA

chr19|19527280|19529517|+|CTC-260F20.3|ENST00000586674.1

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9903

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

6

2

Peptide

AVATVTGR

Amino Acids from 5' Exons

APTNRGLRGSHRAVATVTGRNRPE,RLQIEDFEARIALLPLLQAETDR,AYKSRTSRLASRCCHCYRQKPTG

Amino Acids from 3' Exons

GLGAAAPTCRHGKSGALKCYHLPCPEEETGLGKAVMARADLERRACLPEV,ALELQPPLADMGRAELSSNATTSLVQRRKQAWGRQSWLEQIWNAGPVCQRL,PWSCSPHLPTWEERSLAQMLPPPLSRGGNRPGEGSHGSRFGTQGLFARG