McDonnell Genome Institute

Washington University

CircRNA

chr19|19096090|19106385|+|SLC25A42|ENST00000318596.7

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9743

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

16

3

Peptide

EMTESPAIPSRPGMGNGVK

Amino Acids from 5' Exons

DRVSCHSEQAWYGWCEGRPGAIAGCGCPVLVRLIK,TESPAIPSRPGMGNGVKEGPVRLHEDAEAVLSSSVSSK,PSLLPFRAGLVWVMVRKARCDCMRMLRLSCPRPSHQ

Amino Acids from 3' Exons

SPAPLASPLRRRTGWNDSRFTDLPPGPGQSADGRNPEGN,ALPPWPRLFAGALAGTTAASLTYPLDLVRARMAVTPKE,PCPLGLASSPAHWLERQPLHPTPWTWSERGWPPRRK