McDonnell Genome Institute

Washington University

CircRNA

chr19|18903267|18911071|-|COPE|ENST00000598969.5

Cancer

Type of Peptide

LUAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

1

5

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

12

3

Peptide

WEAAEGLLQEALDKR

Amino Acids from 5' Exons

GGEKLQDAYYIFQEMADKCSPTLLLLNGQAACHMAQGRWEAAEGLLQEALDK,VVRSCRMPTTSSRRWLTSARPPCCCSMGRRPATWPRAAGRPLRACCRRRT,WEAAGCLLHLPGDGQVLAHPAAAQWAGGLPHGPGPLGGRGPAAGGARQ

Amino Acids from 3' Exons

RKFGVVLDEIKPSSAPELQAVRMFADYLAHESRRGPREWVGLRRGAIFKACWLTWVGGGMACSAQHPSDAPLPSAPLLLCASVSLTCTAVGGWWILLQRGGSETVLCVHTPSWTTRHSLNLELKISITEQPSATPRAPRQPRAQRGQGPPISFLIYLFRDGVSL,GSSVWSWMRSSPPRPLSSRPCACLLTTSPTRVGGEAPENGLAGAGPSSRPVGYEPGWVGAWRAAHSIPQIRRLSPLLPCCFVPQFPSPAQQWGAGDGSCFKGEGQRQCCVCTRPHGPQGTLTNKYQLPSSPLQHPEPQDSPGRSGGRALPSVFLFIYLEMESHS,EVRCGPGDQALLGPAPGRAHVCLPRPRESEVRPQRMGWPEARGHLQGLLVMNLGGWGHGVQRTASLRLGASPLCSPAALCLSFPHLHSSGGLVMDPASKGRVRDSAVCAHALMDHKALSEPRTENINYRAALCNTQSPKTAQGAAGAGPSHQFSYLFIRWSLT