McDonnell Genome Institute

Washington University

CircRNA

chr19|18903267|18907112|-|COPE|ENST00000262812.8

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9899

5

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

14

6

Peptide

WEAAEGLLQEALDKGQHRGR

Amino Acids from 5' Exons

GGEKLQDAYYIFQEMADKCSPTLLLLNGQAACHMAQGRWEAAEGLLQEALDK,VVRSCRMPTTSSRRWLTSARPPCCCSMGRRPATWPRAAGRPLRACCRRRT,WEAAGCLLHLPGDGQVLAHPAAAQWAGGLPHGPGPLGGRGPAAGGARQ

Amino Acids from 3' Exons

GQHRGRAGPRDEQERGRDQHHLPAHGRLHLSPRPEPGCRPACAAPGGQPGV,DSIVAELDREMSRSVDVTNTTFLLMAASIYLHDQNPDAALRALHQGDSLE,TASWPSWTERAGAWTPTPPSCSWPPPSISTTRTRMPPCVRCTRGTAWS