McDonnell Genome Institute

Washington University

CircRNA

chr19|18855924|18856300|+|UPF1|ENST00000262803.9

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9005

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

12

2

Peptide

RGPANGEDPPDGAK

Amino Acids from 5' Exons

AGAGVCSEQHRRGPANGEDPPDGAKGRAPLRQEPGHRLPGVFSGPAQPDQEHGQ,PVLVCAPSNIAVDQLTEKIHQTGLKVVRLCAKSREAIDSPVSFLALHNQIRNMD,RCWCVLRATSPWTSRRRSTRRGRSCASAPRAVRPSTPRCLFWPCTTRSGTWT

Amino Acids from 3' Exons

HAAAEAAAAERRDWGAVVCRREAVPGLEAHRRERAAD,MPELQKLQQLKDETGELSSADEKRYRALKRTAERELLM,CLSCRSCSSKTRLGSCRLPTRSGTGPSAPQRESC