McDonnell Genome Institute

Washington University

CircRNA

chr19|17834570|17837213|-|JAK3|ENST00000458235.5

Cancer

Type of Peptide

OSCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9262

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

9

17

Peptide

DLNSLISSVIPGSSELDEPSVVPASR

Amino Acids from 5' Exons

KLQFYEDRQQLPAPKWTELALLIQQCMAYEPVQRPSFRAVIRDLNSLISS,NSNFMRTGSSCRPPSGQSWPCFNSAWPMSRSRGPPSEPSFVTSIASSLQ,TPILGPAAAAGPQVDRAGPADSTVHGLAGPEALLPSRHSPQPHLF

Amino Acids from 3' Exons

SFLEAASLMSQVSYRHLVLLHGVCMAGD,HSWKQRAAKCRTGISCCSTACAWLET,IPGSSELDEPSVVPASRAAPRRVHGWR