McDonnell Genome Institute

Washington University

CircRNA

chr19|17669552|17674756|-|UNC13A|ENST00000252773.11

Cancer

Type of Peptide

LUAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9225

9

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

6

1

Peptide

FELPLEK

Amino Acids from 5' Exons

EGPGEWLTLDSQVIMADSEICGTKDPTFHRILLDTRFELPL,RALESGRWTPRSSWQTVRSVAPRTPPSTASSWTRALSYP,GPWRVADAGLPGHHGRQDLWHQGPHLPPHPPGHALATL

Amino Acids from 3' Exons

RNSTRTPKCRMSRARPSRCGAASPAGSRISC,EIQHVRDPESAECQEHDHRGAGQPAQLGAGFHV,KFNTYVTLKVQNVKSTTIAVRGSQPSWEQDFM