McDonnell Genome Institute

Washington University

CircRNA

chr19|17058548|17060089|-|HAUS8|ENST00000448593.6

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9535

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

9

7

Peptide

ELADVLDAQIAVGSER

Amino Acids from 5' Exons

MENNLAEFERRAEKNLLIMCKEKEKLQKKAHELKRRLLLSQRKRELADVLDAQ,WRTILLSLKEGQKRIYCVRRRRSYRKRPTSSAGFSSLRGSGSWQMSWMP,GEQSCVKKGRKEFINNVGEGEATEKGPRAEAQASPLSEEAGAGRCPGCP

Amino Acids from 3' Exons

IAVGSERVTCSPRCWKGMAQLHLTWISLLLM,QWGRKGPAVHVAGRAWHSSTPGSLCY,SSGVGKGDLQSTLLEGHGTAPPDLDLSAIN