McDonnell Genome Institute

Washington University

CircRNA

chr19|17055860|17060089|-|HAUS8|ENST00000448593.6

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9841

4

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

13

6

Peptide

SIHLEGDGQQLLDSSGVGK

Amino Acids from 5' Exons

IEMLSPFEAVATRFKEQYRTFATALDTTRHELPVRSIHLEGDGQQLL,SRCSAPSRQWPHASRSNTGHSPRPWTLPGTSCPGPSTWREMGSSS,RDAQPLRGSGHTLQGAIQDIRHGPGHYQARAAREVHPPGGRWAAAL

Amino Acids from 3' Exons

IAVGSERVTCSPRCWKGMAQLHLTWISLLLM,QWGRKGPAVHVAGRAWHSSTPGSLCY,SSGVGKGDLQSTLLEGHGTAPPDLDLSAIN