McDonnell Genome Institute

Washington University

CircRNA

chr19|16525241|16525677|-|CHERP|ENST00000198939.6

Cancer

Type of Peptide

CRC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9043

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

14

Peptide

AAHPTAPPGTTAMR

Amino Acids from 5' Exons

PPEQPPYPHHQGGPPHCPPWNNSHEGMWGEQRGDPGWNGQRDAPWNNQPDAAWNSQFEGPWNSQHEQPPWGGGQREPPFRMQRPPHFRGPFPPHQQHPQFNQPPHPHNFNRFPPRFMQDDFPPRHPFERPPYPHRFDYPQGDFPA,RQSSHPTRTTRAAHPTAPPGTTAMRACGASSAVTPAGTASATRPGTTSPTPPGTASSRAPGTASTSSRPGAGASASHPSACSGPHTSGGPSRPTSSTRSSTSLRTPTTSTASRPASCRTTSRHGTPSSGRPIPTASTTPRGTSLP,ARAATLPAPPGRPTPLPPLEQQPGHVGRAARPRLERPARRALEQPARRRLEQPVRGPLEQPARAAALGRGPARATLPHAAAPTLPGALPAPPAAPAVQPASAPPQLQPLPAPLHAGRLPATAPLRAAALSPPLRLPPGGLPC

Amino Acids from 3' Exons

PPEQPPYPHHQGGPPHCPPWNNSHEGMWGEQRGDPGWNGQRDAPWNNQPDAAWNSQFEGPWNSQHEQPPWGGGQREPPFRMQRPPHFRGPFPPHQQHPQFNQPPHPHNFNRFPPRFMQDDFPPRHPFERPPYPHRFDYPQGDFPA,RQSSHPTRTTRAAHPTAPPGTTAMRACGASSAVTPAGTASATRPGTTSPTPPGTASSRAPGTASTSSRPGAGASASHPSACSGPHTSGGPSRPTSSTRSSTSLRTPTTSTASRPASCRTTSRHGTPSSGRPIPTASTTPRGTSLP,ARAATLPAPPGRPTPLPPLEQQPGHVGRAARPRLERPARRALEQPARRRLEQPVRGPLEQPARAAALGRGPARATLPHAAAPTLPGALPAPPAAPAVQPASAPPQLQPLPAPLHAGRLPATAPLRAAALSPPLRLPPGGLPC