McDonnell Genome Institute

Washington University

CircRNA

chr19|16402320|16413845|-|EPS15L1|ENST00000248070.10

Cancer

Type of Peptide

BRCA-HER2-enriched

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9856

5

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

5

2

Peptide

GSFGAMR

Amino Acids from 5' Exons

ARSKLSQLHESRQEAHRSLEQYDQVLDGAHGASLTDLANLSEGVSLAERGSFGAM,QGANFPSCMKAARRPTGAWSSMTRCSMEPMVPAPTWPTAKASPWQRGAVLEP,KEQTFPAAKPPGGPQEPGAVPGARWSPWCQPDRPGQPERRRLPGREGQFWSH

Amino Acids from 3' Exons

REIFTGTRHSRKGRGNQTENQRGA,EKYSLEQDIREKEEAIRQKTSEVQ,RNIHWNKTFEKRKRQSDRKPARC