McDonnell Genome Institute

Washington University

CircRNA

chr19|16392303|16395467|-|EPS15L1|ENST00000248070.10

Cancer

Type of Peptide

HCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9923

27

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

5

2

Peptide

TLPYLRR

Amino Acids from 5' Exons

IHLEGTLSKKVTHSVALPLTTSSRNRQRMTHLPRIHSRKTLPYLR,SIWRGPFQRKPIPWLCHRLLQETDKEPIYLGSIHEKPFLTFE,PFGGDPFKESDPFRGSATDDFFKKQTKNDPFTSDPFTKNPSLPSK

Amino Acids from 3' Exons

DDPFKNKALLFSNNTQELHPDPFQTEDPFKSDPFKGADPFK,MILSKIKPCYLATTRKSCIRILSRQKTPSNLTHLKELTPSK,SFQKSLVIQQHARVASGSFPDRRPLQIPIRSPLQ