McDonnell Genome Institute

Washington University

CircRNA

chr19|16325215|16326032|+|KLF2|ENST00000248071.5

Cancer

Type of Peptide

PRAD

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9958

44

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

9

Peptide

GSPGPGAPR

Amino Acids from 5' Exons

RWPRAEPESGGTDDDLNSVLDFILSMGLDGLGAEAAPEPPPPPPPPAFYYPEPGAPPPYSAPAGGLVSELLRPELDAPLGPALHGRFLLAPPGRLVKAEPPEADGGGGYGCAPGLTRGPRGLKREGAPGPAASCMRGPGGRPPPPPDTPPLSPDGPARLPAPGPRASFPPPFGGPGFGAPGPGLHYAPPAPPAFGLFDDAAAAAAALGLAPPAARGLLTPPASPLELLEAKPKRGRRSWPRKRTATHTCSYAGCGKTYTKSSHLKAHLRTHT,AGRAPNPSPAAPTTTSTACWTSSCPWGWMAWAPRPPRSRRRRPRRLRSITPNPARPRPTAPPRVAWCLSCCDPSWMRRWGPHCTAAFCWRRPAAWSRPSPLKRTAAAATAAPPGPVDRAASSARAPRARRLRACEVPGAAPRRRPTHRRSAPTAPRACPRPVRAPPSRRLSVALVSARPGPACITRRLRPQPSVSSTTRPPPRQPWAWRPPPPAVSSRRLRPRWSCWRPSQSAAAALGPANAPPLTPAATRAAARPTPRVRIRRICARTQ,LAARRTRVRRHRRRPQQRAGLHPVHGAGWPGRRGRPGAAAAAPAACVLLPRTRRAPALQRPRGWPGVAAATRAGCAAGARTARPLSAGAARPPGQGRAPSGRRRRLRLRPRADPWTARPQARGRPGPGGFVHARSRGPPPAAARHTAAQPRRPRAPARARSARLLPAAFRWPWFRRARARPALRAACAPSLRSLRRRGRRRGSPGPGAPRRPRSPHAACVPAGAAGGQAKARPPLLAPQTHRHSHLQLRGLRQDLHQEFASEGASAHAH

Amino Acids from 3' Exons

RWPRAEPESGGTDDDLNSVLDFILSMGLDGLGAEAAPEPPPPPPPPAFYYPEPGAPPPYSAPAGGLVSELLRPELDAPLGPALHGRFLLAPPGRLVKAEPPEADGGGGYGCAPGLTRGPRGLKREGAPGPAASCMRGPGGRPPPPPDTPPLSPDGPARLPAPGPRASFPPPFGGPGFGAPGPGLHYAPPAPPAFGLFDDAAAAAAALGLAPPAARGLLTPPASPLELLEAKPKRGRRSWPRKRTATHTCSYAGCGKTYTKSSHLKAHLRTHT,AGRAPNPSPAAPTTTSTACWTSSCPWGWMAWAPRPPRSRRRRPRRLRSITPNPARPRPTAPPRVAWCLSCCDPSWMRRWGPHCTAAFCWRRPAAWSRPSPLKRTAAAATAAPPGPVDRAASSARAPRARRLRACEVPGAAPRRRPTHRRSAPTAPRACPRPVRAPPSRRLSVALVSARPGPACITRRLRPQPSVSSTTRPPPRQPWAWRPPPPAVSSRRLRPRWSCWRPSQSAAAALGPANAPPLTPAATRAAARPTPRVRIRRICARTQ,LAARRTRVRRHRRRPQQRAGLHPVHGAGWPGRRGRPGAAAAAPAACVLLPRTRRAPALQRPRGWPGVAAATRAGCAAGARTARPLSAGAARPPGQGRAPSGRRRRLRLRPRADPWTARPQARGRPGPGGFVHARSRGPPPAAARHTAAQPRRPRAPARARSARLLPAAFRWPWFRRARARPALRAACAPSLRSLRRRGRRRGSPGPGAPRRPRSPHAACVPAGAAGGQAKARPPLLAPQTHRHSHLQLRGLRQDLHQEFASEGASAHAH