McDonnell Genome Institute

Washington University

CircRNA

chr19|16152551|16154491|+|HSH2D|ENST00000535834.1

Cancer

Type of Peptide

OV

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9856

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

8

2

Peptide

AAVTEAVDLR

Amino Acids from 5' Exons

GCELAGVTATGILSHQGQSQPCGLHTLLQVRPGPGSRAGAGGLLGFLGGGKGCFMSLLRKQQLRLWIERELLAKQVKLLSVVACFIGQPLYSCVINGGNGTARLVTCWVLHGQVKKPAWEPGVVWLQRCRPKGWGLGAGMRGSRMSQPPQCLRRAQSSCCHFMVKLLDDGTFMIPGEKVAHTSLDALVTFHQQKPIEPRRELLTQPCRQ,DAENLLESQPLGSFLIRVSHSHVGYTLSYKGLGRDPGQGQVGSWVSLEGARGASCHSFSESSSNGCGSENGSCPSNESFCPWHVLSEASLCTPVLMGETEAQRGPAGCCMASERSLHGNLGSGCSSDAAGPRAGDLGQGGGVGCPSPRSVSAEPKAAAAISWSSWMMGLSSPGRRWPTPRWTPWSPSTSRSQLSRAGSCHSPAG,MLRTCWSHSHWDPFSSGSVTAMWATHSPTSKAWAGIQGRGRWALGFPWRGQGVLHVIASQKAAVTEAVDLRTGAASQAMSEAFVRSGMFYLRPAFVLLCYKWGKLRHSEVSNLLGVAWPVSEEACMGTWGSLAVAVTLPAQGLGTWGRDEGEDVPAPAVSPQSPKQLLPFHGEALGWDFHDPRGEGGPHLAGRPGHLPPAEANAAQGAADTALQA

Amino Acids from 3' Exons

KDPANVDYEDLFLYSNAVAEEAACPVSAPEE,RIPQTWITRISSSTPTQWPRKLPARCLPLR,GSRKRGLRGSLPLLQRSGRGSCLPGVCPG