McDonnell Genome Institute

Washington University

CircRNA

chr19|15426981|15431182|-|WIZ|ENST00000599686.3

Cancer

Type of Peptide

OV

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9999

12

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

10

Peptide

VAAEVPHGSK

Amino Acids from 5' Exons

PQAQSQHETSAASSVVSSSRTARASRATRAPICGKWAPSGTSMARPSTRCGRSRDGPSLGLVDLPTHQGQAQKPWPRWAAQVLAAHWKPAAPRTFTSHPWPRSCHHHRAAPWATHQLPLLLLRPERCSQAWLHPPCPRSSLNKYGWRSSGRCCRGPFMGNCTHLRVPGGHHGKTHPTC,LRPRASTRHPLRVLWVLREPQGPLEPRALPSAANGRDRVVRQWLAHRHAAGDPEETDPVSAWWTSQPTRAKPKSPGQDDGRRRSWQLTGSPQPLGPSHLTLGQEVATTTGQPPGPLTNCLSSSYGPKDVPRPGCTLLAQEAEATNTGGDQAGDAAGGPSWGTAPIGSLGGTTGRHDTPEP,SGPEPARDIRCEFCGEFFENRKGLSSHARSHLRQMGVTEWYVNGSPIDTLREILKRRTQSRPGGPPNPPGPSPKALAKMMGGAGPGSSLEARSPSDLHISPLAKKLPPPPGSPLGHSPTASPPPTARKMFPGLAAPSLPKKLKPEQIRVEIKREMLPGALHGELHPSEGPWGAPREDMTPLNL

Amino Acids from 3' Exons

AWVLRKTQWWPWTWALPRSLRRACLSLGPWSRWPVGAAKWLQRFLMAANRSCRTSR,PGFGKRNGGHGLGLSLAPEEPACPWGPGAGGQSAEQQSGCRGSSWQQTGAAGPQ,LGSEENAMVAMDLGSPSLPKKSLPVPGALEQVASRLSSKVAAEVPHGSKQELQDLK