McDonnell Genome Institute

Washington University

CircRNA

chr19|15372850|15377014|-|AKAP8|ENST00000269701.6

Cancer

Type of Peptide

CCRC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9825

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

9

Peptide

GVLDLPTPR

Amino Acids from 5' Exons

LLPLPAVRVLLQALPAGAQPLPPQLQLRLVRPGVRPQWQLWGAVQMPRPSPGAGLPWLHAGPGPGPLPGPEQPWHLHAQRPLRAPRCVLAPVHALERAELRGWTGPGRALPQPATSVPLLPVHGSRLRRDGHAGGGRLQHHALRMWPLAASDAGSGS,SFRFQPFESYDSRPCLPEHNPYRPSYSYDYEFDLGSDRNGSFGGQYSECRDPARERGSLDGFMRGRGQGRFQDRSNPGTFMRSDPFVPPAASSEPLSTPWNELNYVGGRGLGGPSPSRPPPSLFSQSMAPDYGVMGMQGAGGYDSTMPYGCGRSQPRMRDRDR,PSASSRSSPMTPGPACRSTTPTAPATATTMSSTWGPTAMAALGGSTVNAETQPGSGAPLMASCGAGARAASRTGATLAPSCAATPSCPPLRPLSPCPRPGTSTTWVDGAWEGPPPAGHLRPSSPSPWLPTTAWACRGRAAMTAPCPTDVAARSLGCGIGI

Amino Acids from 3' Exons

ATGRGVLDLPTPR,LRGVECWTCQHP,YGAWSAGPANTQ