McDonnell Genome Institute

Washington University

CircRNA

chr19|14458030|14458375|+|PKN1|ENST00000242783.10

Cancer

Type of Peptide

EOGC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9773

16

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

4

3

Peptide

ASLWSWK

Amino Acids from 5' Exons

VKSALCLSWITQWWGRRLGSHVAPMPGTRASLWSWK,SQHCAAGHSGGADVLEAMWPQCLGPELHSGAGK,EVSTVLKLDNTVVGQTSWKPCGPNAWDQSFTLELER

Amino Acids from 3' Exons

ARELELAVFWRDQRGLCALKFLKLEDFLDNERHEVQLDMEPQGCLVAE,HGNWSWLCSGGTSGACVPSNSSWRISWTMRGMRCSWTWNPRAAWWL,TGTGVGCVLAGPAGPVCPQIPEVGGFLGQEAGAAGHGTPGLPGG