McDonnell Genome Institute

Washington University

CircRNA

chr19|14409535|14409873|-|DDX39A|ENST00000242776.8

Cancer

Type of Peptide

OV

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9061

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

6

3

Peptide

LHGPGPAPR

Amino Acids from 5' Exons

VIIFVKSVQRCMALAQLLVEQNFPAIAIHRGMAQEE,SSSSQCSAAWPWPSSSWSRTSRPSPSTGAWPRRS,DNLRQVSAALHGPGPAPRGAELPGHRHPPGHGPGGA

Amino Acids from 3' Exons

PMEVFVDDETKLTLHGLQQYYVKLKDSEKNRKLFDLLDVLEFNQ,PWRCLWTTRPSSRCTACSSTTSNSKTVRRTASSLISWMCWSLT,HGGVCGRRDQAHAARPAAVLRQTQRQEEPQALSLGCAGVP