McDonnell Genome Institute

Washington University

CircRNA

chr19|1428841|1430362|+|DAZAP1|ENST00000233078.8

Cancer

Type of Peptide

BRCA-HER2-enriched

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9995

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

17

Peptide

SPPTSCPPLLEAFPLPR

Amino Acids from 5' Exons

VEVKRAEPRDSKSQAPGQPGASQWGSRVVPNAANGWAGQPPPTWQQGYGPQ,WKLNELSLGTARAKRRDSQVPASGGAGLCPTLPMAGQASPRPRGSKDMARK,GSTSASGQQEPSAGTARCQPVGEPGCAQRCQWLGRPAPAHVAARIWPA

Amino Acids from 3' Exons

VAMDRPLQEEEPPRHPHRSPPTSCPPLLEAFPLPRASLRATVPRHSS,WLWTAPCRKRSPPATPTVHLLHRVHPSWRLSPSPGLPSGLRCPATV,GYGPPPAGRGAPPPPPPFTSYIVSTPPGGFPPPQGFPQGYGAPPQF