McDonnell Genome Institute

Washington University

CircRNA

chr19|13812996|13814865|+|ZSWIM4|ENST00000590508.5

Cancer

Type of Peptide

CCRC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9586

13

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

7

Peptide

ELQAAEK

Amino Acids from 5' Exons

GPCGFASSAPTANQRKGQAGSSYSAGGTSSTSAHWKRATTPSTAPACSPPWPPPQ,GPVGLRRPEPPLQTRGKGRLAPATQQVGQARRLPTGRGQLLLRRPQPAAHHGPRP,ALWVCVVLSPHCKPEERAGWLQLLSRWDKLDVCPLEEGNYSFDGPSLQPTMAPAP

Amino Acids from 3' Exons

ARRKRKRWQPQVPATRYLAAPCWLESYTGMTPTCRGSWPVTPTGPASQAAWVGTNRLSTPRAAHCGWENLSPLPVPVWTPCVPTDTPARPCGWQVPSSTHSGCSSGISRATSSRKK,LGGRGRGGSHKSPPHGIWPRLAGWRATLERLPAEDPGQLLRAQPHRQRGWGQTDFRPPGPPTVAGRTFPHCLCPCGHPACPRIPPPGPAAGKCHHQHTPAAAAASARELQAAEK,SEEEEEVAATSPRHTVFGRALLAGELHWNDAYLQRILASDSYGPSLTGSVGGDKPTFDPQGRPLWLGEPFPTACARVDTLRAHGYPRQALRLASAIINTLRLQQRHQLESYKQQKK