McDonnell Genome Institute

Washington University

CircRNA

chr19|12799858|12799989|-|PRDX2|ENST00000301522.2

Cancer

Type of Peptide

CCRC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9566

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

9

13

Peptide

LVQAFQYTDEHGEGASLSSMAR

Amino Acids from 5' Exons

GPLYHRWQGCPSPDHCFACGTLRGGSAAGPGLPVHRRAWG,GLFIIDGKGVLRQITVNDLPVGRSVDEALRLVQAFQYTDEHGE,ASLSSMARVSFARSLLMICLWDAPWMRLCGWSRPSSTQTSMGK

Amino Acids from 3' Exons

GPLYHRWQGCPSPDHCFACGTLRGGSAAGPGLPVHRRAWG,GLFIIDGKGVLRQITVNDLPVGRSVDEALRLVQAFQYTDEHGE,ASLSSMARVSFARSLLMICLWDAPWMRLCGWSRPSSTQTSMGK