top of page

McDonnell Genome Institute

Washington University

CircRNA

chr19|1271328|1274440|+|CIRBP|ENST00000587169.5

Cancer

Type of Peptide

OSCC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9183

10

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

30

Peptide

GPGQDSGKGGLRAAMTSGVTVPGGTSPGTR

Amino Acids from 5' Exons

SVDGRQIRVDQAGKSSDNRSRGYRGGSAGGRGFFRGGRGRGRGFSR,LMDGRSETRQASRQTTDPVGTVVALPGAGASSVGAEDGAVGSLE,CRWTADPSRPGRQVVRQPIPWVPWWLCRGPGLLPWGPRTGPWVL

Amino Acids from 3' Exons

PESEWWLQPELGRVLQRQLQLRVTLRGRHAAVACGGSSVHLGALSKHFRLDTQTLSLCLPRRGASVLSEPFLSQDAKAKDPKRQGRARARWAVSVHVWPQASLPRLWGVVAPRPQAAPWSGLWGEAASCCFGAFTLCLLLVLSYTQRVKTLPAQDRPSNGCVFKDCGSFAERCVVNAPPCIPTFVVISVLILSNPAPLLTPGWPRYTFLFKEVLFFFEGFQNILKSIYFFDHEPVFKKIGGCVGFWFLFFLVALPFFFWGWPHEVGAPLTSLRSNGLIRSLSEAEQAVAFFQLRVTFLSVVWDPGGCGSNCPGAPAPASICAVRPTVDVQTSLRGSRCLFILSFFTGRRTHTPSMLYLQWLRNSCTQFSLALRSRLKDRVKTLLQFPCIAPHTPCCGLLQPDLSRERRWRSSGSASLPWGLQSKGRPSRLALVRVGEPGGGRERAAQASGQPWEASGSGGQRAGLCGQLSRDSGRAPDADLDCLSLEAGQRAEARGIPGRPQTASRLASSAVASRVLSILCPMEAAALGGQKCCAPNRTLDASCSLGLICGNSPVIRGNSFRSCPHPSCELTESHVPGECSCDCFLFFLFFLTLFLFFSIKLELKSGPAITLPTCSQVQPGPSHAWLIDEIPAGLKTSERPRLLDFLLNPSFPDLFKSHSLSFLCLLPPLVFFSPHWPTLHPIRVAGSSCAKVQTRPGHAGLRSLRSQPPDPETFLGAVAVSGEAGRGSCEPCGGRWERCFALAGRGPARTRGRVAEQRPLGSLSQEGLHLEQELEAAACPGGLSP,RSQSGGYSDRSSGGSYRDSYDSYGKSHSEGATLLWPAVGARFTLVPSPSTLGWTLRPCHCACPEEAHLSSQSHFYRRTQKPNETDQKGKGERGPAGQSARCMCGRRPASLGCGGWLLPGRRPRPGLASGVKLPLVASVPLHCACFLSSATHNEKPFLLKIVLPMAVCLKIVGASLNVNVMHLLVFPLSSFRFSCQTQPDRFRRDGLVTRLFFLRKCCFFLRVFKTFKAFTFLTTSHEFSKKSGVVWVFGFCFSFWLRCLFFFSGVGPMKWVPHSLLDRTDCESALCRKLSKLWLFSNSVRFVCGRTPAGVAATALEPQPLRPSVLCAPQTCRRPEVLEDVYLYCPFLLEDVRILHRCCICSGGILVRSFLWLYEADKTVNEPCSDNSLALHHTLLAAGSCSQTAEREGGEAAGLQAFPGACRARKGGPADWRWSGGSQAGDGSGQLRPQGSPGRLLAVVARGLDCAGSLAGTVDVHLTLTWTASVKQAREQRHVASQGDLRRPAGLVLLLLHEFAFSASLWKLQPSEDRSVVRPTEPSETQAAPLASSYVEIALFEVTPSARVHIPLVESSLKVMCPGNVPVTVFCFSFFFLCFCFFQLSWNSQAQPLRSPRAARCSLGPVMPGSMKSLKQDRPVNAPAFWIFCSIDRLFQTSLSHTLNLAFSDVCCRHFFSRAHTGPHSSIPYGLAPAAPRCRPALGMLACDGAGHSPLTSLRPSGLWLFPGRPGGAAVSPVEDVGSNAALLWQVEGARPGLGEGWPESSDDLWGHCPRRDFTWNKSWRQPLAQEACP,GVRVVATVTGARAGPTETVMTVTVSHTPRAPRCCGLRWELGSPWCPLQALAGHSDLVTVLAQKRRICPLRAISIAGRKSQMRLTKKARESEGPLGSQLGACVAAGQPPSAVGGGCSPAAGRALVWPLGSCLLLLRCLYTVPASCPQLHTTSKNPSCSRSSFQWLCVRLWELRTLMCSKCTSLYSHFRSHFGSDLVKPSLTASDAGMASLLDFSFGSAVFFGFSKHFEKHLLFPRAMSFQKNRGLCGFLVFVLVFGCVAFFFLVGLAPSGCPTHFSEIERTVNPLFVGSASCGFFPTPCDVSECSVVGPRRVWQQLPWSPSPCVHLCCAPHSRRADVPERFLKMFIYIVLFYWKTYAYSIDVVFAVAEEFLYAVFFGFTKPIKRPCEMNLALTIPLHCTTHSLLRAPAARPEQREKVEKQRVCKPSLGPAELEREAQQTGAGQGRGARRGTGAGSSGLRAALGGFWQWWPEGWTVRAAQGQWTCTRPGLPQSRSRPESRGTWHPRATSDGQPVSFCCCFTSSEHSLLAYGSCSPRRTEVLCAQQNPLRRKLLPWLAHMWKPCNSRLLPLVSTSLLLRAHKSCARGMFLLFFVFPFFFNFVFVFFNAGTKVRPSHYAPHVQPGAAWAQSCLAHRNPLSRIEDQTPPPFGFFAQLTVFSRPLVTLLTLSLMSVAAISFFLEPTLAHIAPSHTGSWLQLRQGADPPWACWPVTEPEVTAPLADLPRGCGCFRGGREGQLALWRTLGVTLLCFGRLKGPGQDSGKGGLRAAMTSGVTVPGGTSPGTRAGGSRLPRRLVP

bottom of page