McDonnell Genome Institute

Washington University

CircRNA

chr19|11547796|11549469|+|CNN1|ENST00000252456.6

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9511

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

4

24

Peptide

LGTDQPLDQATISLQMGTNKGASQAKTK

Amino Acids from 5' Exons

AKTKGNKVNVGVKYAEKQERKFEPGKLREGRNIIGLQ,RRRKETRTWESTQRSRSGNSSRGSEKGGTSLGC,EDERKQGERGSEVRREAGAEIRAGEAKRRAEHHWAA

Amino Acids from 3' Exons

MGTNKFASQQGMTAYGTRRHLYDPKLGTDQPLDQATISLQMGTNKGASQ,WAPTSLPASRARPMAPGATSTTPSWAQTSLWTRRPSACRWAPTKEPA,GHQQVCQPAGHDGLWHPAPPLRPQAGHRPASGPGDHQPADGHQQRSQP