McDonnell Genome Institute

Washington University

CircRNA

chr19|11227336|11229390|-|DOCK6|ENST00000590680.5

Cancer

Type of Peptide

LUAD

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9989

5

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

8

Peptide

AIDCNSSR

Amino Acids from 5' Exons

VKSMALHLLLGQRLDTPRKLRFPGRFLDDITALVGSVGLEVITRVHK,RVWRCTCCLASDTHPASCASPDASWTTSLPWWALWAWRSSPVST,EEYGAAPAAWPATRHTPQAALPRTLPGRHHCLGGLCGPGGHHPCPQ

Amino Acids from 3' Exons

AIDCNSSRASSYLEGSSSAPPATQLRPTVQK,PSTATLAEPPPTSRVPPRPHQPPSDPLCR,HRLQLPSLLLPRGFLLGPTSHPAETHCAE