McDonnell Genome Institute

Washington University

CircRNA

chr19|10819979|10830378|+|DNM2|ENST00000355667.10

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9987

12

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

1

10

Peptide

IPPGIPPGVPR

Amino Acids from 5' Exons

EKEKKYMLPLDNLKIRDVEKGFMSNKHVFAIFNTEQ,RKRRSTCCLWTTSRSVMWRRASCPTSTSSPSSTRSR,EREEVHAASGQPQDPCGEGLHVQQARLRHLQHGAE

Amino Acids from 3' Exons

PHSTAPTGVQHTPPWPAPSSEGPHSRAPPDSCSRGGSSLLLGAPNPIPAWTPERVCQQPLPSPASDPISASSDPPRDSPRSAQ,PTPQRRPVSSIHPPGRPPAVRGPTPGPPLIPVPVGAAASFSAPPIPSRPGPQSVFANSDLFPAPPQIPSRPVRIPPGIPPGVP,PLHSADRCPAYTPLAGPQQGAPLQGPPFLFPWGQQPPSRRPQSHPGLDPRACLPTVTSSQPRLRSHLGQFGSPQGFPQECP