McDonnell Genome Institute

Washington University

CircRNA

chr19|10670973|10671535|+|ILF3|ENST00000250241.12

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9106

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

4

10

Peptide

VADNLAIQLARPMR

Amino Acids from 5' Exons

RPMRIFVNDDRHVMAKHSSVYPTQEELEAVQNMVSHTERALKAVSDWIDEQEKGSSEQAESDNMDVPPEDDSKEGA,VQCEFLMMTAMWQSILPFIQHKRSWRQSRTWCPTRSGRSKLCPTGTSRKRVAASRQSPITWMCPQRTTVKKGL,SNANFCEPPCDGKAFFRLSNTRGAGGSPEHGVPHGAGAQSCVRLDRRAGKGQRAGRVRHGCAPRGRQRRGW

Amino Acids from 3' Exons

GTEDGAHDQNPAGSDAGGPGGKGPPTQGGLGSGAGAAVGEAHNRPPGQGGRQPGHPAC,EQKTEHMTRTLRGVMRVGLVAKGLLLKGDLDLELVLLCKEKPTTALLDKVADNLAIQLA,NRRRSTPEPCGECGWAWWQRASYSRGTWIWSWCCCVRRSPQPPSWTRWPTTWPSSL