McDonnell Genome Institute

Washington University

CircRNA

chr19|10583605|10584070|-|AP1M2|ENST00000591676.1

Cancer

Type of Peptide

BRCA-HER2-enriched

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9719

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

3

5

Peptide

TIEPLISR

Amino Acids from 5' Exons

PLISRNYKGDVAMSKIEHFMPLLVQREEEGALAPLLSHGQVHFLWIKHSNLYCIHPTWCPWRWVWGLSAMVAAQAKRGWAEDRSCTAHLCGLGWGAGAGRDEGGGKGQGGGSGSVFHLLLHKWHLFLNLAAPVVATTSKNANASLVYSFLYKTIE,HSAATTRAMWPARLSTSCLCWYSGRRKAPWPRCATARSTSYGSNTATSTVSTPRGVPGGGCGGCRRWWQLRPREGGLRTGVAPHISVAAGGQGQVEMRVVARDRVEVRGLYSIYFSINGTFSLTLLPQWWPPHRRMPMPPWCTPSCIRQ,IDQPQLQGRCGHEQDALHAFAGTAGGGRRPGPAAEPRPGPLPMDQTQQPLLYPPHVVSLEVGVGAVGDGGSSGQERVGGQELHRTSLWLRLGGRGRRGWWQGTGWRFGVCIPFTSPMAPFPPCCPSGGHHIEECQCLPGVLLPVDNR

Amino Acids from 3' Exons

PLISRNYKGDVAMSKIEHFMPLLVQREEEGALAPLLSHGQVHFLWIKHSNLYCIHPTWCPWRWVWGLSAMVAAQAKRGWAEDRSCTAHLCGLGWGAGAGRDEGGGKGQGGGSGSVFHLLLHKWHLFLNLAAPVVATTSKNANASLVYSFLYKTIE,HSAATTRAMWPARLSTSCLCWYSGRRKAPWPRCATARSTSYGSNTATSTVSTPRGVPGGGCGGCRRWWQLRPREGGLRTGVAPHISVAAGGQGQVEMRVVARDRVEVRGLYSIYFSINGTFSLTLLPQWWPPHRRMPMPPWCTPSCIRQ,IDQPQLQGRCGHEQDALHAFAGTAGGGRRPGPAAEPRPGPLPMDQTQQPLLYPPHVVSLEVGVGAVGDGGSSGQERVGGQELHRTSLWLRLGGRGRRGWWQGTGWRFGVCIPFTSPMAPFPPCCPSGGHHIEECQCLPGVLLPVDNR