McDonnell Genome Institute

Washington University

CircRNA

chr19|10461003|10461999|+|PDE4A|ENST00000589073.1

Cancer

Type of Peptide

PRAD

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9119

3

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

14

Peptide

KMVIDMVGGAGAGR

Amino Acids from 5' Exons

AVFTDLEILAALFAAAIHDVDHPGVSNQFLINT,QCSRTWRFSPPSSRLPSTMWITLGSPTSSSSTP,SVHGPGDSRRPLRGCHPRCGSPWGLQPVPHQH

Amino Acids from 3' Exons

IRSWRSCTTMSRCSRITTWPWASSCCRRTTATSSRTSASASGRAYARWSSTWWAGLGRDGAGKEAESRALGRSGSESQRNPQPGQSGRLLPGENFRGPGQSGGRVSAAPVTPPCPQVLATDMSKHMTLLADLKTMVETKKVTSSGVLLLDNYSDRIQ,FGAGAHVQRVGARESPPGRGLQAAAGGQLRHLPEPQQAPAAEPTQDGHRHGGRGWGGTERERKPRSRGLWGGVGLSPRGTLNLDRAGGFYLVKTSEARVSLGGGCQRPQRPLARRCWPRTCPSTPSWLTRPWWRPRKPAQGSSCITTPTAS,SELALMYNDESVLENHHLAVGFKLLQEDNCDIFQNLSKRQRQSLRKMVIDMVGGAGAGRSGKGSLGVEGFGEEWVVPEEPSTWTERAASTWKLQRPGSVWGAGVSGPSDAPLPAGAGHGHVQAHDPPGPEDHGGDQESDQLRGPPARLLRPHP