McDonnell Genome Institute

Washington University

CircRNA

chr19|10319165|10323566|-|RAVER1|ENST00000293677.10

Cancer

Type of Peptide

OV

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

1

48

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

8

3

Peptide

EPALGPHGPSR

Amino Acids from 5' Exons

DMGPRRLFSHPREPALGPHGPSRHK,TWDLGGSSPTHGNQPLGLTDPADT,HGTSAALLPPTGTSPWASRTQPTQ

Amino Acids from 3' Exons

LACGQDGQLKGFAVLEYETAEMAEEAQQQADGLSLGGSHLRVSFCAPGPPGRSMLAALIAAQAT,WRAARMGSRASRCWSMRRLRWRRRHSSRRTACPWGAATCESPSAPLGPPAAVCWPLSSLPRP,GVRPGWAAEGLRGAGVDGDGGGGTAAGGRPVPGGQPPASLLLRPWAPRPQYAGRSHRCPGH