McDonnell Genome Institute

Washington University

CircRNA

chr19|10151397|10166685|-|DNMT1|ENST00000340748.8

Cancer

Type of Peptide

HCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.932

10

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

13

Peptide

NTQTETEGGAGQR

Amino Acids from 5' Exons

VSQYGHEGGRRGSRHPRDAVTQKNAPGEEEETEQESHLLGRRSRQ,CPNMAMKEADDDEEVDDNIPEMPSPKKMHQGKKKKQNKNRISWVGEAVK,VPIWPRRQMTMRKSMITSQRCRHPKKCTRGRRRNRTRIASLGSEKPS

Amino Acids from 3' Exons

NTQTETEGGAGQRSQGRRAGRGRRWRRE,TPKQKLKEEPDREARAGVQADEDEDGDEK,HPNRNRRSRTEKPGQACRLTRTKMETR