McDonnell Genome Institute

Washington University

CircRNA

chr18|8069685|8343520|+|PTPRM|ENST00000332175.12

Cancer

Type of Peptide

EOGC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9695

33

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

7

Peptide

LEDGVAR

Amino Acids from 5' Exons

IPCEAQENKWRSNLGKSLSAGSHLDIMLVATVIISLSTTVTKLEDKNKCEKKAGIQKTHTLNTRSLTCHHTPMSVNSSTQRAGRKAKNSCRQMKT,SHARPKKTRSSGGQISANHYPLGAIWICNSLPQLSHCPLLLPSWRTRTSARRSKLGYRKLTPSTHDHPVTIHQCQCETDPHEPRGPEGKPRTHSADRR,PMRGPRKLEVVEVKSRQITIRWEPFGYNVTRCHSYNLTVHYCYQVGGQEQVREEVSWDTENSHPQHTITNLSPYTNVSVKLILMNPEGRKESQELIVQTDED

Amino Acids from 3' Exons

GQCRKPSMTSGGWCGTKTLQVSSWPILWKWE,ANAGNHLLLEDGVARKHCKYHHGDQSCGSGK,PMQETIYDFWRMVWHENTASIIMVTNLVEVGR