McDonnell Genome Institute

Washington University

CircRNA

chr18|79433578|79461366|+|NFATC1|ENST00000253506.9

Cancer

Type of Peptide

PRAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9435

6

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

21

7

Peptide

LTGTCASRPTLPALDWQLPSHSGPYELR

Amino Acids from 5' Exons

PDPARPGLAAAVPLRPVASDGAAQVPPPSPLRDGGQPGGREGVGRRTPHRA,PTLPALDWQLPSHSGPYELRIEVQPKSHHRAHYETEGSRGAVKASAGGHPIVQ,RPCPPWTGSCRPTQARMSFGLRCSPSPTTEPTTRRRAAGGPRRRPEDTPSC

Amino Acids from 3' Exons

MATMSGRWKRKLTGTCAS,WPPCLGDGSENPGPVQA,GHHVWEMEAKTDRDLCKP