McDonnell Genome Institute

Washington University

CircRNA

chr18|79433578|79448984|+|NFATC1|ENST00000253506.9

Cancer

Type of Peptide

CCRC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9421

3

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

19

3

Peptide

AVPTLPALDWQLPSHSGPYELR

Amino Acids from 5' Exons

PDPARPGLAAAVPLRPVASDGAAQVPPPSPLRDGGQPGGREGVGRRTPHRA,PTLPALDWQLPSHSGPYELRIEVQPKSHHRAHYETEGSRGAVKASAGGHPIVQ,RPCPPWTGSCRPTQARMSFGLRCSPSPTTEPTTRRRAAGGPRRRPEDTPSC

Amino Acids from 3' Exons

LHGYLENEPLMLQLFIGTADDRLLRPHAFYQVHRITGKTVSTTSHEAILSNTKVLEIPLLPENSMRA,CMATWRMSRCCSFSLGRRTTACCARTPSTRCTASQGRPCPPPATRPSSPTPKSWRSHSCRRTACEP,AWLLGEAADAAAFHWDGGRPPAAPARLLPGAPHHREDRVHHQPRGHPLQHQSPGDPTPAGEQHASR